Lineage for d5afna_ (5afn A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2084600Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2084601Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2084602Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
    automatically mapped to Pfam PF02931
  6. 2084696Protein automated matches [190922] (2 species)
    not a true protein
  7. 2084977Species Human (Homo sapiens) [TaxId:9606] [189722] (6 PDB entries)
  8. 2084978Domain d5afna_: 5afn A: [272130]
    automated match to d1uw6a_
    complexed with bma, gol, l0b, man, nag, ojd

Details for d5afna_

PDB Entry: 5afn (more details), 2.22 Å

PDB Description: alpha7-achbp in complex with lobeline and fragment 5
PDB Compounds: (A:) acetylcholine-binding protein, neuronal acetylcholine receptor subunit alpha-7

SCOPe Domain Sequences for d5afna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5afna_ b.96.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gefqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswt
dhylqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsi
rqrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkr
serfyecckepypdvtftvtfrkkg

SCOPe Domain Coordinates for d5afna_:

Click to download the PDB-style file with coordinates for d5afna_.
(The format of our PDB-style files is described here.)

Timeline for d5afna_: