SCOPe 2.05: Domain d1cbrb_: 1cbr B:

Lineage for d1cbrb_ (1cbr B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Cellular retinoic-acid-binding protein (CRABP) [50861] (2 species)

7. Species Cow and mouse (Bos taurus) and (Mus musculus), CRABP-I, identical sequences [TaxId:9913] [50863] (3 PDB entries)

8. Domain d1cbrb_: 1cbr B: [27213]
   CASP1
   complexed with rea

Details for d1cbrb_

PDB Entry: 1cbr, 2.9 Å

PDB Description: crystal structure of cellular retinoic-acid-binding proteins i and ii in complex with all-trans-retinoic acid and a synthetic retinoid

PDB Compounds: (B:) cellular retinoic acid binding protein type I

SCOPe Domain Sequences for d1cbrb_:

Sequence; same for both SEQRES and ATOM records:

>d1cbrb_ b.60.1.2 (B:) Cellular retinoic-acid-binding protein (CRABP) {Cow and mouse (Bos taurus) and (Mus musculus), CRABP-I, identical sequences [TaxId: 9913]}
pnfagtwkmrssenfdellkalgvnamlrkvavaaaskphveirqdgdqfyiktsttvrt
teinfkvgegfeeetvdgrkcrslptwenenkihctqtllegdgpktywtrelandelil
tfgaddvvctriyvre

Timeline for d1cbrb_:

• d1cbrb_ first appeared (with stable ids) in SCOP 1.55
  
• d1cbrb_ appears in SCOPe 2.04
  
• d1cbrb_ appears in SCOPe 2.06
  
• d1cbrb_ appears in the current release, SCOPe 2.08