Class b: All beta proteins [48724] (93 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) |
Superfamily b.60.1: Lipocalins [50814] (3 families) |
Family b.60.1.2: Fatty acid binding protein-like [50847] (10 proteins) |
Protein Cellular retinoic-acid-binding protein (CRABP) [50861] (2 species) |
Species Cow and mouse (Bos taurus) and (Mus musculus), CRABP-I, identical sequences [TaxId:9913] [50863] (3 PDB entries) |
Domain d1cbrb_: 1cbr B: [27213] |
PDB Entry: 1cbr (more details), 2.9 Å
SCOP Domain Sequences for d1cbrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cbrb_ b.60.1.2 (B:) Cellular retinoic-acid-binding protein (CRABP) {Cow and mouse (Bos taurus) and (Mus musculus), CRABP-I, identical sequences} pnfagtwkmrssenfdellkalgvnamlrkvavaaaskphveirqdgdqfyiktsttvrt teinfkvgegfeeetvdgrkcrslptwenenkihctqtllegdgpktywtrelandelil tfgaddvvctriyvre
Timeline for d1cbrb_: