Lineage for d1cbrb_ (1cbr B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 16455Fold b.60: Lipocalins [50813] (1 superfamily)
  4. 16456Superfamily b.60.1: Lipocalins [50814] (3 families) (S)
  5. 16579Family b.60.1.2: Fatty acid binding protein-like [50847] (10 proteins)
  6. 16596Protein Cellular retinoic-acid-binding protein (CRABP) [50861] (2 species)
  7. 16597Species Cow and mouse (Bos taurus) and (Mus musculus), CRABP-I, identical sequences [TaxId:9913] [50863] (3 PDB entries)
  8. 16602Domain d1cbrb_: 1cbr B: [27213]

Details for d1cbrb_

PDB Entry: 1cbr (more details), 2.9 Å

PDB Description: crystal structure of cellular retinoic-acid-binding proteins i and ii in complex with all-trans-retinoic acid and a synthetic retinoid

SCOP Domain Sequences for d1cbrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cbrb_ b.60.1.2 (B:) Cellular retinoic-acid-binding protein (CRABP) {Cow and mouse (Bos taurus) and (Mus musculus), CRABP-I, identical sequences}
pnfagtwkmrssenfdellkalgvnamlrkvavaaaskphveirqdgdqfyiktsttvrt
teinfkvgegfeeetvdgrkcrslptwenenkihctqtllegdgpktywtrelandelil
tfgaddvvctriyvre

SCOP Domain Coordinates for d1cbrb_:

Click to download the PDB-style file with coordinates for d1cbrb_.
(The format of our PDB-style files is described here.)

Timeline for d1cbrb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1cbra_