Lineage for d2cbra_ (2cbr A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 16455Fold b.60: Lipocalins [50813] (1 superfamily)
  4. 16456Superfamily b.60.1: Lipocalins [50814] (3 families) (S)
  5. 16579Family b.60.1.2: Fatty acid binding protein-like [50847] (10 proteins)
  6. 16596Protein Cellular retinoic-acid-binding protein (CRABP) [50861] (2 species)
  7. 16597Species Cow and mouse (Bos taurus) and (Mus musculus), CRABP-I, identical sequences [TaxId:9913] [50863] (3 PDB entries)
  8. 16600Domain d2cbra_: 2cbr A: [27211]

Details for d2cbra_

PDB Entry: 2cbr (more details), 2.8 Å

PDB Description: cellular retinoic acid binding protein i in complex with a retinobenzoic acid (am80)

SCOP Domain Sequences for d2cbra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cbra_ b.60.1.2 (A:) Cellular retinoic-acid-binding protein (CRABP) {Cow and mouse (Bos taurus) and (Mus musculus), CRABP-I, identical sequences}
pnfagtwkmrssenfdellkalgvnamlrkvavaaaskphveirqdgdqfyiktsttvrt
teinfkvgegfeeetvdgrkcrslptwenenkihctqtllegdgpktywtrelandelil
tfgaddvvctriyvre

SCOP Domain Coordinates for d2cbra_:

Click to download the PDB-style file with coordinates for d2cbra_.
(The format of our PDB-style files is described here.)

Timeline for d2cbra_: