Class b: All beta proteins [48724] (93 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) |
Superfamily b.60.1: Lipocalins [50814] (3 families) |
Family b.60.1.2: Fatty acid binding protein-like [50847] (10 proteins) |
Protein Cellular retinoic-acid-binding protein (CRABP) [50861] (2 species) |
Species Cow and mouse (Bos taurus) and (Mus musculus), CRABP-I, identical sequences [TaxId:9913] [50863] (3 PDB entries) |
Domain d2cbra_: 2cbr A: [27211] |
PDB Entry: 2cbr (more details), 2.8 Å
SCOP Domain Sequences for d2cbra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cbra_ b.60.1.2 (A:) Cellular retinoic-acid-binding protein (CRABP) {Cow and mouse (Bos taurus) and (Mus musculus), CRABP-I, identical sequences} pnfagtwkmrssenfdellkalgvnamlrkvavaaaskphveirqdgdqfyiktsttvrt teinfkvgegfeeetvdgrkcrslptwenenkihctqtllegdgpktywtrelandelil tfgaddvvctriyvre
Timeline for d2cbra_: