Lineage for d4za2a_ (4za2 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2847950Species Pectobacterium carotovorum [TaxId:555] [272070] (2 PDB entries)
  8. 2847951Domain d4za2a_: 4za2 A: [272103]
    automated match to d4avya_
    complexed with nad

Details for d4za2a_

PDB Entry: 4za2 (more details), 1.55 Å

PDB Description: crystal structure of pectobacterium carotovorum 2-keto-3-deoxy-d- gluconate dehydrogenase complexed with nad+
PDB Compounds: (A:) 2-deoxy-D-gluconate 3-dehydrogenase

SCOPe Domain Sequences for d4za2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4za2a_ c.2.1.0 (A:) automated matches {Pectobacterium carotovorum [TaxId: 555]}
milnsfdlqgkvalitgcdtglgqgmaiglaqagcdivgvnivepkdtiekvtalgrrfl
sltadmsnvsghaelvekavaefghvdilvnnagiirredaiefseknwddvmnlniksv
ffmsqtvarqfikqgkggkiiniasmlsfqggirvpsytasksavmgvtrlmanewakhg
invnaiapgymatnntqqlradeerskeildripagrwglpqdlmgpsvflassasdyin
gytiavdggwlar

SCOPe Domain Coordinates for d4za2a_:

Click to download the PDB-style file with coordinates for d4za2a_.
(The format of our PDB-style files is described here.)

Timeline for d4za2a_: