Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain |
Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins) Pfam PF00452 |
Protein automated matches [190236] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188722] (88 PDB entries) |
Domain d4zbij1: 4zbi J:172-322 [272099] Other proteins in same PDB: d4zbia2, d4zbib2, d4zbic2, d4zbid2, d4zbie2, d4zbif2, d4zbig2, d4zbih2, d4zbii2, d4zbij2, d4zbik2, d4zbil2 automated match to d2mhsa_ complexed with 4m6 |
PDB Entry: 4zbi (more details), 2.5 Å
SCOPe Domain Sequences for d4zbij1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zbij1 f.1.4.1 (J:172-322) automated matches {Human (Homo sapiens) [TaxId: 9606]} delyrqsleiisrylreqatgakdtkpmgrsgatsrkaletlrrvgdgvqrnhetafqgm lrkldikneddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqesciepla esitdvlvrtkrdwlvkqrgwdgfveffhve
Timeline for d4zbij1: