SCOP 1.73: Domain d1blra_: 1blr A:

Lineage for d1blra_ (1blr A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (8 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (17 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Cellular retinoic-acid-binding protein (CRABP) [50861] (2 species)

7. Species Human (Homo sapiens), CRABP-II [TaxId:9606] [50862] (10 PDB entries)

8. Domain d1blra_: 1blr A: [27208]

Details for d1blra_

PDB Entry: 1blr

PDB Description: nmr solution structure of human cellular retinoic acid binding protein-type ii, 22 structures

PDB Compounds: (A:) cellular retinoic acid binding protein-type II

SCOP Domain Sequences for d1blra_:

Sequence; same for both SEQRES and ATOM records:

>d1blra_ b.60.1.2 (A:) Cellular retinoic-acid-binding protein (CRABP) {Human (Homo sapiens), CRABP-II [TaxId: 9606]}
pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvrt
teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtreltndgeli
ltmtaddvvctrvyvre

Timeline for d1blra_:

• d1blra_ first appeared (with stable ids) in SCOP 1.55, called d1blr__
  
• d1blra_ was called d1blr__ in SCOP 1.71
  
• d1blra_ appears in SCOP 1.75
  
• d1blra_ appears in the current release, SCOPe 2.08