Lineage for d1blr__ (1blr -)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 564341Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 564342Superfamily b.60.1: Lipocalins [50814] (5 families) (S)
    bind hydrophobic ligands in their interior
  5. 564567Family b.60.1.2: Fatty acid binding protein-like [50847] (16 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 564595Protein Cellular retinoic-acid-binding protein (CRABP) [50861] (2 species)
  7. 564602Species Human (Homo sapiens), CRABP-II [TaxId:9606] [50862] (7 PDB entries)
  8. 564610Domain d1blr__: 1blr - [27208]

Details for d1blr__

PDB Entry: 1blr (more details)

PDB Description: nmr solution structure of human cellular retinoic acid binding protein-type ii, 22 structures

SCOP Domain Sequences for d1blr__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1blr__ b.60.1.2 (-) Cellular retinoic-acid-binding protein (CRABP) {Human (Homo sapiens), CRABP-II}
pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvrt
teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtreltndgeli
ltmtaddvvctrvyvre

SCOP Domain Coordinates for d1blr__:

Click to download the PDB-style file with coordinates for d1blr__.
(The format of our PDB-style files is described here.)

Timeline for d1blr__: