Lineage for d1blr__ (1blr -)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.60: Lipocalins [50813] (1 superfamily) Superfamily b.60.1: Lipocalins [50814] (3 families) 
Family b.60.1.2: Fatty acid binding protein-like [50847] (12 proteins) 
Protein Cellular retinoic-acid-binding protein (CRABP) [50861] (2 species) Species Human (Homo sapiens), CRABP-II [TaxId:9606] [50862] (7 PDB entries) 
Domain d1blr__: 1blr - [27208]
Details for d1blr__
PDB Entry: 1blr (more details)
PDB Description: nmr solution structure of human cellular retinoic acid binding protein-type ii, 22 structures
SCOP Domain Sequences for d1blr__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1blr__ b.60.1.2 (-) Cellular retinoic-acid-binding protein (CRABP) {Human (Homo sapiens), CRABP-II}
pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvrt
teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtreltndgeli
ltmtaddvvctrvyvre
SCOP Domain Coordinates for d1blr__:
Click to download the PDB-style file with coordinates for d1blr__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1blr__:
- d1blr__ first appeared (with stable ids) in SCOP 1.55
- d1blr__ appears in SCOP 1.59
- d1blr__ appears in the current release, SCOPe 2.08, called d1blra_
View in 3D