Lineage for d1blra_ (1blr A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804862Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2804935Protein Cellular retinoic-acid-binding protein (CRABP) [50861] (2 species)
  7. 2804942Species Human (Homo sapiens), CRABP-II [TaxId:9606] [50862] (76 PDB entries)
  8. 2805040Domain d1blra_: 1blr A: [27208]

Details for d1blra_

PDB Entry: 1blr (more details)

PDB Description: nmr solution structure of human cellular retinoic acid binding protein-type ii, 22 structures
PDB Compounds: (A:) cellular retinoic acid binding protein-type II

SCOPe Domain Sequences for d1blra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1blra_ b.60.1.2 (A:) Cellular retinoic-acid-binding protein (CRABP) {Human (Homo sapiens), CRABP-II [TaxId: 9606]}
pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvrt
teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtreltndgeli
ltmtaddvvctrvyvre

SCOPe Domain Coordinates for d1blra_:

Click to download the PDB-style file with coordinates for d1blra_.
(The format of our PDB-style files is described here.)

Timeline for d1blra_: