Lineage for d4zahg1 (4zah G:1-376)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132505Species Escherichia coli [TaxId:83333] [257757] (4 PDB entries)
  8. 2132516Domain d4zahg1: 4zah G:1-376 [272068]
    Other proteins in same PDB: d4zaha2, d4zahb2, d4zahc2, d4zahd2, d4zahe2, d4zahf2, d4zahg2, d4zahh2
    automated match to d4wfpf_
    complexed with t5k

Details for d4zahg1

PDB Entry: 4zah (more details), 2.24 Å

PDB Description: crystal structure of sugar aminotransferase wece with external aldimine vii from escherichia coli k-12
PDB Compounds: (G:) dTDP-4-amino-4,6-dideoxygalactose transaminase

SCOPe Domain Sequences for d4zahg1:

Sequence, based on SEQRES records: (download)

>d4zahg1 c.67.1.0 (G:1-376) automated matches {Escherichia coli [TaxId: 83333]}
mipfnappvvgteldymqsamgsgklcgdggftrrcqqwleqrfgsakvlltpsctasle
maallldiqpgdevimpsytfvstanafvlrgakivfvdvrpdtmnidetlieaaitdkt
rvivpvhyagvacemdtimalakkhnlfvvedaaqgvmstykgralgtighigcfsfhet
knytaggeggatlindkalieraeiirekgtnrsqffrgqvdkytwrdigssylmsdlqa
aylwaqleaadrinqqrlalwqnyydalaplakagrielpsipdgcvqnahmfyiklrdi
ddrsalinflkeaeimavfhyiplhgcpagehfgefhgedryttkeserllrlplfynls
pvnqrtviatllnyfs

Sequence, based on observed residues (ATOM records): (download)

>d4zahg1 c.67.1.0 (G:1-376) automated matches {Escherichia coli [TaxId: 83333]}
mipfnappvvgteldymqsamgsgklcgdggftrrcqqwleqrfgsakvlltpsctasle
maallldiqpgdevimpsytfvstanafvlrgakivfvdvrpdtmnidetlieaaitdkt
rvivpvhyagvacemdtimalakkhnlfvvedaaqgvmstykgralgtighigcfsfhet
knytaggeggatlindkalieraeiirekgtnrytwrdigssylmsdlqaaylwaqleaa
drinqqrlalwqnyydalaplakagrielpsipdgcvqnahmfyiklrdiddrsalinfl
keaeimavfhyiplhgcpagehfgefhgedryttkeserllrlplfynlspvnqrtviat
llnyfs

SCOPe Domain Coordinates for d4zahg1:

Click to download the PDB-style file with coordinates for d4zahg1.
(The format of our PDB-style files is described here.)

Timeline for d4zahg1:

  • d4zahg1 first appeared in SCOPe 2.05, called d4zahg_