![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) ![]() |
![]() | Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
![]() | Protein automated matches [190151] (166 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83333] [257757] (5 PDB entries) |
![]() | Domain d4zahe1: 4zah E:1-376 [272064] Other proteins in same PDB: d4zaha2, d4zahb2, d4zahc2, d4zahd2, d4zahe2, d4zahf2, d4zahg2, d4zahh2 automated match to d4wfpf_ complexed with t5k |
PDB Entry: 4zah (more details), 2.24 Å
SCOPe Domain Sequences for d4zahe1:
Sequence, based on SEQRES records: (download)
>d4zahe1 c.67.1.0 (E:1-376) automated matches {Escherichia coli [TaxId: 83333]} mipfnappvvgteldymqsamgsgklcgdggftrrcqqwleqrfgsakvlltpsctasle maallldiqpgdevimpsytfvstanafvlrgakivfvdvrpdtmnidetlieaaitdkt rvivpvhyagvacemdtimalakkhnlfvvedaaqgvmstykgralgtighigcfsfhet knytaggeggatlindkalieraeiirekgtnrsqffrgqvdkytwrdigssylmsdlqa aylwaqleaadrinqqrlalwqnyydalaplakagrielpsipdgcvqnahmfyiklrdi ddrsalinflkeaeimavfhyiplhgcpagehfgefhgedryttkeserllrlplfynls pvnqrtviatllnyfs
>d4zahe1 c.67.1.0 (E:1-376) automated matches {Escherichia coli [TaxId: 83333]} mipfnappvvgteldymqsamgsgklcgdggftrrcqqwleqrfgsakvlltpsctasle maallldiqpgdevimpsytfvstanafvlrgakivfvdvrpdtmnidetlieaaitdkt rvivpvhyagvacemdtimalakkhnlfvvedaaqgvmstykgralgtighigcfsfhet knytaggeggatlindkalieraeiirekgtnrytwrdigssylmsdlqaaylwaqleaa drinqqrlalwqnyydalaplakagrielpsipdgcvqnahmfyiklrdiddrsalinfl keaeimavfhyiplhgcpagehfgefhgedryttkeserllrlplfynlspvnqrtviat llnyfs
Timeline for d4zahe1: