SCOPe 2.07: Domain d4ys7b_: 4ys7 B:

Lineage for d4ys7b_ (4ys7 B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (136 PDB entries)

8. Domain d4ys7b_: 4ys7 B: [272060]
   Other proteins in same PDB: d4ys7a2
   automated match to d4lm4b_
   complexed with 4gk, mg, zn

Details for d4ys7b_

PDB Entry: 4ys7, 2.5 Å

PDB Description: co-crystal structure of 2-[2-(5,8-dimethyl[1,2,4]triazolo[1,5- a]pyrazin-2-yl)ethyl]-3-methyl-3h-imidazo[4,5-f]quinoline (compound 39) with pde10a

PDB Compounds: (B:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d4ys7b_:

Sequence; same for both SEQRES and ATOM records:

>d4ys7b_ a.211.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
seewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfi
msvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsn
sylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiia
tdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandi
yaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepll
kacrdnlsqwekvirge

Timeline for d4ys7b_:

• d4ys7b_ first appeared in SCOPe 2.05
  
• d4ys7b_ appears in SCOPe 2.06
  
• d4ys7b_ appears in the current release, SCOPe 2.08