Lineage for d4yr1a1 (4yr1 A:9-449)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2155479Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily)
    core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 43516728, strand 7 is antiparallel to the rest
  4. 2155480Superfamily c.76.1: Alkaline phosphatase-like [53649] (6 families) (S)
  5. 2155481Family c.76.1.1: Alkaline phosphatase [53650] (2 proteins)
    common fold is decorated with several large insertions
    automatically mapped to Pfam PF00245
  6. 2155482Protein Alkaline phosphatase [53651] (4 species)
  7. 2155490Species Escherichia coli [TaxId:562] [53652] (44 PDB entries)
  8. 2155571Domain d4yr1a1: 4yr1 A:9-449 [272055]
    Other proteins in same PDB: d4yr1a2, d4yr1b2
    automated match to d1kh7a_
    complexed with gol, po4, zn

Details for d4yr1a1

PDB Entry: 4yr1 (more details), 2.24 Å

PDB Description: crystal structure of e. coli alkaline phosphatase d101a/d153a in complex with inorganic phosphate
PDB Compounds: (A:) alkaline phosphatase

SCOPe Domain Sequences for d4yr1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yr1a1 c.76.1.1 (A:9-449) Alkaline phosphatase {Escherichia coli [TaxId: 562]}
nraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseitaarnyaega
ggffkgidalpltgqythyalnkktgkpdyvtasaasatawstgvktyngalgvdihekd
hptilemakaaglatgnvstaelqaatpaalvahvtsrkcygpsatsekcpgnalekggk
gsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsdaaslnsvte
anqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptlaqmtdkaie
llsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkegntlvivta
dhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlriaaygphaan
vvgltdqtdlfytmkaalglk

SCOPe Domain Coordinates for d4yr1a1:

Click to download the PDB-style file with coordinates for d4yr1a1.
(The format of our PDB-style files is described here.)

Timeline for d4yr1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4yr1a2