Lineage for d4y5vb_ (4y5v B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2368397Domain d4y5vb_: 4y5v B: [272048]
    Other proteins in same PDB: d4y5va_, d4y5vc1, d4y5vc2, d4y5vd_, d4y5vf1, d4y5vf2, d4y5vg_, d4y5vi1, d4y5vi2
    automated match to d3t0va_
    complexed with gol, peg, pge

Details for d4y5vb_

PDB Entry: 4y5v (more details), 2.6 Å

PDB Description: diabody 305 complex with epor
PDB Compounds: (B:) Diabody 305 VL domain

SCOPe Domain Sequences for d4y5vb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y5vb_ b.1.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqsaltqpasvsgspgqsitisctgtssdvggyiyvswyqqhpgkapklmiydvsrrpsg
isdrfsgsksgntasltisglqaedeadyycnsyttlstwlfgggtkvtvl

SCOPe Domain Coordinates for d4y5vb_:

Click to download the PDB-style file with coordinates for d4y5vb_.
(The format of our PDB-style files is described here.)

Timeline for d4y5vb_: