| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
| Domain d4y5vb_: 4y5v B: [272048] Other proteins in same PDB: d4y5va_, d4y5vc1, d4y5vc2, d4y5vd_, d4y5vf1, d4y5vf2, d4y5vg_, d4y5vi1, d4y5vi2 automated match to d3t0va_ complexed with gol, peg, pge |
PDB Entry: 4y5v (more details), 2.6 Å
SCOPe Domain Sequences for d4y5vb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4y5vb_ b.1.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqsaltqpasvsgspgqsitisctgtssdvggyiyvswyqqhpgkapklmiydvsrrpsg
isdrfsgsksgntasltisglqaedeadyycnsyttlstwlfgggtkvtvl
Timeline for d4y5vb_: