Lineage for d4y5vf1 (4y5v F:9-116)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2762155Protein automated matches [190888] (2 species)
    not a true protein
  7. 2762158Species Human (Homo sapiens) [TaxId:9606] [188282] (33 PDB entries)
  8. 2762206Domain d4y5vf1: 4y5v F:9-116 [272046]
    Other proteins in same PDB: d4y5va_, d4y5vb_, d4y5vd_, d4y5ve_, d4y5vg_, d4y5vh_
    automated match to d1eerb1
    complexed with gol, peg, pge

Details for d4y5vf1

PDB Entry: 4y5v (more details), 2.6 Å

PDB Description: diabody 305 complex with epor
PDB Compounds: (F:) erythropoietin receptor

SCOPe Domain Sequences for d4y5vf1:

Sequence, based on SEQRES records: (download)

>d4y5vf1 b.1.2.1 (F:9-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pkfeskaallaargpeellcfterledlvcfweeaasagvgpgqysfsyqledepwklcr
lhqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihin

Sequence, based on observed residues (ATOM records): (download)

>d4y5vf1 b.1.2.1 (F:9-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pkfeskaallaargpeellcfterledlvcfweeaapgqysfsyqledepwklcrlhqap
targavrfwcslptadtssfvplelrvtaasgapryhrvihin

SCOPe Domain Coordinates for d4y5vf1:

Click to download the PDB-style file with coordinates for d4y5vf1.
(The format of our PDB-style files is described here.)

Timeline for d4y5vf1: