| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
| Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
| Protein automated matches [190888] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188282] (33 PDB entries) |
| Domain d4y5vf1: 4y5v F:9-116 [272046] Other proteins in same PDB: d4y5va_, d4y5vb_, d4y5vd_, d4y5ve_, d4y5vg_, d4y5vh_ automated match to d1eerb1 complexed with gol, peg, pge |
PDB Entry: 4y5v (more details), 2.6 Å
SCOPe Domain Sequences for d4y5vf1:
Sequence, based on SEQRES records: (download)
>d4y5vf1 b.1.2.1 (F:9-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pkfeskaallaargpeellcfterledlvcfweeaasagvgpgqysfsyqledepwklcr
lhqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihin
>d4y5vf1 b.1.2.1 (F:9-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pkfeskaallaargpeellcfterledlvcfweeaapgqysfsyqledepwklcrlhqap
targavrfwcslptadtssfvplelrvtaasgapryhrvihin
Timeline for d4y5vf1: