Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188740] (183 PDB entries) |
Domain d4y5va_: 4y5v A: [272043] Other proteins in same PDB: d4y5vb_, d4y5vc1, d4y5vc2, d4y5ve_, d4y5vf1, d4y5vf2, d4y5vh_, d4y5vi1, d4y5vi2 automated match to d2p49b_ complexed with gol, peg, pge |
PDB Entry: 4y5v (more details), 2.6 Å
SCOPe Domain Sequences for d4y5va_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4y5va_ b.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} sevqlvesggglvqpggslrlscaasgftfssywmswvrqapgkglewvanikpdgseky yvdsvkgrftisrdnaknsvylqmnslraedtavyycarvsrggsysdwgqgtlvtvssg g
Timeline for d4y5va_: