![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
![]() | Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
![]() | Protein automated matches [190888] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188282] (33 PDB entries) |
![]() | Domain d4y5vc2: 4y5v C:117-223 [272042] Other proteins in same PDB: d4y5va_, d4y5vb_, d4y5vd_, d4y5ve_, d4y5vg_, d4y5vh_ automated match to d1cn4b2 complexed with gol, peg, pge |
PDB Entry: 4y5v (more details), 2.6 Å
SCOPe Domain Sequences for d4y5vc2:
Sequence, based on SEQRES records: (download)
>d4y5vc2 b.1.2.1 (C:117-223) automated matches {Human (Homo sapiens) [TaxId: 9606]} evvlldapvglvarladesghvvlrwlpppetpmtshiryevdvsagqgagsvqrveile grtecvlsnlrgrtrytfavrarmaepsfggfwsawsepvslltpsd
>d4y5vc2 b.1.2.1 (C:117-223) automated matches {Human (Homo sapiens) [TaxId: 9606]} evvlldapvglvarladesghvvlrwlpppetpmtshiryevdvsagqgsvqrveilegr tecvlsnlrgrtrytfavrarmaepsfggfwsawsepvslltpsd
Timeline for d4y5vc2: