Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein automated matches [190888] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188282] (30 PDB entries) |
Domain d4y5vc1: 4y5v C:9-116 [272041] Other proteins in same PDB: d4y5va_, d4y5vb_, d4y5vd_, d4y5ve_, d4y5vg_, d4y5vh_ automated match to d1eerb1 complexed with gol, peg, pge |
PDB Entry: 4y5v (more details), 2.6 Å
SCOPe Domain Sequences for d4y5vc1:
Sequence, based on SEQRES records: (download)
>d4y5vc1 b.1.2.1 (C:9-116) automated matches {Human (Homo sapiens) [TaxId: 9606]} pkfeskaallaargpeellcfterledlvcfweeaasagvgpgqysfsyqledepwklcr lhqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihin
>d4y5vc1 b.1.2.1 (C:9-116) automated matches {Human (Homo sapiens) [TaxId: 9606]} pkfeskaallaargpeellcfterledlvcfweeapgqysfsyqledepwklcrlhqapt agavrfwcslptadtssfvplelrvtaasgapryhrvihin
Timeline for d4y5vc1: