SCOPe 2.05: Domain d1cbqa_: 1cbq A:

Lineage for d1cbqa_ (1cbq A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Cellular retinoic-acid-binding protein (CRABP) [50861] (2 species)

7. Species Human (Homo sapiens), CRABP-II [TaxId:9606] [50862] (34 PDB entries)

8. Domain d1cbqa_: 1cbq A: [27204]
   complexed with po4, re9

Details for d1cbqa_

PDB Entry: 1cbq, 2.2 Å

PDB Description: crystal structure of cellular retinoic-acid-binding proteins i and ii in complex with all-trans-retinoic acid and a synthetic retinoid

PDB Compounds: (A:) cellular retinoic acid binding protein type II

SCOPe Domain Sequences for d1cbqa_:

Sequence; same for both SEQRES and ATOM records:

>d1cbqa_ b.60.1.2 (A:) Cellular retinoic-acid-binding protein (CRABP) {Human (Homo sapiens), CRABP-II [TaxId: 9606]}
pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvrt
teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtreltndgeli
ltmtaddvvctrvyvre

Timeline for d1cbqa_:

• d1cbqa_ first appeared (with stable ids) in SCOP 1.55, called d1cbq__
  
• d1cbqa_ appears in SCOPe 2.04
  
• d1cbqa_ appears in SCOPe 2.06
  
• d1cbqa_ appears in the current release, SCOPe 2.08