Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
Protein automated matches [190039] (120 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:208964] [196922] (4 PDB entries) |
Domain d4y0mi_: 4y0m I: [272034] automated match to d1i6aa_ |
PDB Entry: 4y0m (more details), 2.3 Å
SCOPe Domain Sequences for d4y0mi_:
Sequence, based on SEQRES records: (download)
>d4y0mi_ c.94.1.0 (I:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]} aqlaaplkvgaiytigpylfphlipqlhrvapqmplyieenfthilrdklrtgeldaiii alpfqeadvltkplfdepfyvlmpadhpwtakasidsellndksllllgeghcfrdqvle acptvrkgdenkhttvesssletirhmvasglgvsvlpfsavdshhyapgvievrpfsap vpfrtvaiawrasfprpraievladsirlcs
>d4y0mi_ c.94.1.0 (I:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]} aqlaaplkvgaiytigpylfphlipqlhrvapqmplyieenfthilrdklrtgeldaiii alpfqeadvltkplfdepfyvlmpadhpwtakasidsellndksllllgeghcfrdqvle acphttvesssletirhmvasglgvsvlpfsavdshhyapgvievrpfsapvpfrtvaia wrasfprpraievladsirlcs
Timeline for d4y0mi_: