Lineage for d4y0me_ (4y0m E:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1879042Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1879043Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1880254Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 1880255Protein automated matches [190039] (120 species)
    not a true protein
  7. 1880822Species Pseudomonas aeruginosa [TaxId:208964] [196922] (4 PDB entries)
  8. 1880835Domain d4y0me_: 4y0m E: [272032]
    automated match to d1i6aa_

Details for d4y0me_

PDB Entry: 4y0m (more details), 2.3 Å

PDB Description: the reduced form of oxyr regulatory domain from psedomonas aeruginosa
PDB Compounds: (E:) OxyR

SCOPe Domain Sequences for d4y0me_:

Sequence, based on SEQRES records: (download)

>d4y0me_ c.94.1.0 (E:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
qlaaplkvgaiytigpylfphlipqlhrvapqmplyieenfthilrdklrtgeldaiiia
lpfqeadvltkplfdepfyvlmpadhpwtakasidsellndksllllgeghcfrdqvlea
cptvrkgdenkhttvesssletirhmvasglgvsvlpfsavdshhyapgvievrpfsapv
pfrtvaiawrasfprpraievladsirlc

Sequence, based on observed residues (ATOM records): (download)

>d4y0me_ c.94.1.0 (E:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
qlaaplkvgaiytigpylfphlipqlhrvapqmplyieenfthilrdklrtgeldaiiia
lpfqeadvltkplfdepfyvlmpadhpwtakasidsellndksllllgeghcfrdqvlea
cphttvesssletirhmvasglgvsvlpfsavdshhyapgvievrpfsapvpfrtvaiaw
rasfprpraievladsirlc

SCOPe Domain Coordinates for d4y0me_:

Click to download the PDB-style file with coordinates for d4y0me_.
(The format of our PDB-style files is described here.)

Timeline for d4y0me_: