SCOPe 2.08: Domain d4y0md1: 4y0m D:88-297

Lineage for d4y0md1 (4y0m D:88-297)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [196922] (8 PDB entries)

8. Domain d4y0md1: 4y0m D:88-297 [272031]
   Other proteins in same PDB: d4y0ma2, d4y0mc2, d4y0md2, d4y0mg2, d4y0mh2, d4y0mi2, d4y0mj2, d4y0ml2
   automated match to d1i6aa_

Details for d4y0md1

PDB Entry: 4y0m, 2.3 Å

PDB Description: the reduced form of oxyr regulatory domain from psedomonas aeruginosa

PDB Compounds: (D:) OxyR

SCOPe Domain Sequences for d4y0md1:

Sequence, based on SEQRES records:

>d4y0md1 c.94.1.0 (D:88-297) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
qlaaplkvgaiytigpylfphlipqlhrvapqmplyieenfthilrdklrtgeldaiiia
lpfqeadvltkplfdepfyvlmpadhpwtakasidsellndksllllgeghcfrdqvlea
cptvrkgdenkhttvesssletirhmvasglgvsvlpfsavdshhyapgvievrpfsapv
pfrtvaiawrasfprpraievladsirlcs

Sequence, based on observed residues (ATOM records):

>d4y0md1 c.94.1.0 (D:88-297) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
qlaaplkvgaiytigpylfphlipqlhrvapqmplyieenfthilrdklrtgeldaiiia
lpfqeadvltkplfdepfyvlmpadhpwtakasidsellndksllllgeghcfrdqvlea
cpkhttvesssletirhmvasglgvsvlpfsavdshhyapgvievrpfsapvpfrtvaia
wrasfprpraievladsirlcs

Timeline for d4y0md1:

• d4y0md1 first appeared in SCOPe 2.05, called d4y0md_
  
• d4y0md1 appears in SCOPe 2.07