Lineage for d4xwib_ (4xwi B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2898275Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2898276Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2899284Family c.68.1.0: automated matches [191551] (1 protein)
    not a true family
  6. 2899285Protein automated matches [190951] (34 species)
    not a true protein
  7. 2899411Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [272021] (1 PDB entry)
  8. 2899413Domain d4xwib_: 4xwi B: [272027]
    automated match to d3duva_
    complexed with na, so4

Details for d4xwib_

PDB Entry: 4xwi (more details), 1.92 Å

PDB Description: x-ray crystal structure of cmp-kdo synthase from pseudomonas aeruginosa
PDB Compounds: (B:) 3-deoxy-manno-octulosonate cytidylyltransferase

SCOPe Domain Sequences for d4xwib_:

Sequence, based on SEQRES records: (download)

>d4xwib_ c.68.1.0 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
tqaftvviparyastrlpgkplqdiagqpmiqrvwnqarksaasrvvvatdderilaacq
gfgaealltraehnsgtdrleevasrlglasdaivvnvqgdeplippalidqvaanlaah
peaaiatlaepihevsalfnpnvvkvatdidglaltfsraplpwardafardrdslpegv
pyrrhigiyayrvgfladfvawgpcwlenaesleqlralwhgvrihvadarenm

Sequence, based on observed residues (ATOM records): (download)

>d4xwib_ c.68.1.0 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
tqaftvviparykplqdiagqpmiqrvwnqarksaasrvvvatdderilaacqgfgaeal
ltraehnsgtdrleevasrlglasdaivvnvqgdeplippalidqvaanlaahpeaaiat
laepihevsalfnpnvvkvatdidglaltfsraplpwardafardrdslpegvpyrrhig
iyayrvgfladfvawgpcwlenaesleqlralwhgvrihvadarenm

SCOPe Domain Coordinates for d4xwib_:

Click to download the PDB-style file with coordinates for d4xwib_.
(The format of our PDB-style files is described here.)

Timeline for d4xwib_: