Lineage for d4xwsb_ (4xws B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2916002Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [196922] (8 PDB entries)
  8. 2916030Domain d4xwsb_: 4xws B: [272026]
    automated match to d1i69a_
    mutant

Details for d4xwsb_

PDB Entry: 4xws (more details), 3.01 Å

PDB Description: oxyr regulatory domain c199d mutant from pseudomonas aeruginosa
PDB Compounds: (B:) OxyR

SCOPe Domain Sequences for d4xwsb_:

Sequence, based on SEQRES records: (download)

>d4xwsb_ c.94.1.0 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
aaplkvgaiytigpylfphlipqlhrvapqmplyieenfthilrdklrtgeldaiiialp
fqeadvltkplfdepfyvlmpadhpwtakasidsellndksllllgeghdfrdqvleacp
tvrkgdenkhttvesssletirhmvasglgvsvlpfsavdshhyapgvievrpfsapvpf
rtvaiawrasfprpraievladsirlcs

Sequence, based on observed residues (ATOM records): (download)

>d4xwsb_ c.94.1.0 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
aaplkvgaiytigpylfphlipqlhrvapqmplyieenfthilrdklrtgeldaiiialp
fqeadvltkplfdepfyvlmpadhpwtakasidsellndksllllgeghdfnkhttvess
sletirhmvasglgvsvlpfsavdshhyapgvievrpfsapvpfrtvaiawrasfprpra
ievladsirlcs

SCOPe Domain Coordinates for d4xwsb_:

Click to download the PDB-style file with coordinates for d4xwsb_.
(The format of our PDB-style files is described here.)

Timeline for d4xwsb_: