Class b: All beta proteins [48724] (174 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins) ten-stranded meander beta-sheet folded upon itself relates to the common fold by opening the barrel and insertion of beta-hairpin |
Protein Cellular retinoic-acid-binding protein (CRABP) [50861] (2 species) |
Species Human (Homo sapiens), CRABP-II [TaxId:9606] [50862] (30 PDB entries) |
Domain d3cbsa_: 3cbs A: [27202] complexed with r12 |
PDB Entry: 3cbs (more details), 2 Å
SCOPe Domain Sequences for d3cbsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cbsa_ b.60.1.2 (A:) Cellular retinoic-acid-binding protein (CRABP) {Human (Homo sapiens), CRABP-II [TaxId: 9606]} pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvrt teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtreltndgeli ltmtaddvvctrvyvre
Timeline for d3cbsa_: