SCOPe 2.05: Domain d4xnyl1: 4xny L:1-106

Lineage for d4xnyl1 (4xny L:1-106)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [268548] (95 PDB entries)

8. Domain d4xnyl1: 4xny L:1-106 [272019]
   Other proteins in same PDB: d4xnyl2
   automated match to d1dn0a1
   complexed with nag

Details for d4xnyl1

PDB Entry: 4xny, 2.3 Å

PDB Description: crystal structure of broadly and potently neutralizing antibody vrc08c in complex with hiv-1 clade a strain q842.d12 gp120

PDB Compounds: (L:) light chain of antibody vrc08c

SCOPe Domain Sequences for d4xnyl1:

Sequence; same for both SEQRES and ATOM records:

>d4xnyl1 b.1.1.0 (L:1-106) automated matches {Homo sapiens [TaxId: 9606]}
yigltqspgtlsvspgeratlscrpsqaiskshlawysqksgqpprllltgtyerasgvp
drfvgsgsgtnytltiasveaedfavyfcqcfegfgqgtklei

Timeline for d4xnyl1:

• d4xnyl1 is new in SCOPe 2.05-stable
  
• d4xnyl1 appears in SCOPe 2.06
  
• d4xnyl1 appears in the current release, SCOPe 2.08