Lineage for d4xq3e_ (4xq3 E:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2057136Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2057137Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2057725Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 2057726Protein automated matches [190914] (13 species)
    not a true protein
  7. 2057958Species Sulfolobus solfataricus [TaxId:555311] [272009] (1 PDB entry)
  8. 2057963Domain d4xq3e_: 4xq3 E: [272015]
    automated match to d1th7b_

Details for d4xq3e_

PDB Entry: 4xq3 (more details), 2.6 Å

PDB Description: crystal structure of sso-smap2
PDB Compounds: (E:) Like-Sm ribonucleoprotein core

SCOPe Domain Sequences for d4xq3e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xq3e_ b.38.1.0 (E:) automated matches {Sulfolobus solfataricus [TaxId: 555311]}
enplkslrtainrivlvklkdgseyigkleqtdgtmnlvlrdcteiregtsepvakygrv
lirgsnilfisvdyetv

SCOPe Domain Coordinates for d4xq3e_:

Click to download the PDB-style file with coordinates for d4xq3e_.
(The format of our PDB-style files is described here.)

Timeline for d4xq3e_: