Class b: All beta proteins [48724] (177 folds) |
Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) |
Family b.38.1.0: automated matches [191538] (1 protein) not a true family |
Protein automated matches [190914] (13 species) not a true protein |
Species Sulfolobus solfataricus [TaxId:555311] [272009] (1 PDB entry) |
Domain d4xq3e_: 4xq3 E: [272015] automated match to d1th7b_ |
PDB Entry: 4xq3 (more details), 2.6 Å
SCOPe Domain Sequences for d4xq3e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xq3e_ b.38.1.0 (E:) automated matches {Sulfolobus solfataricus [TaxId: 555311]} enplkslrtainrivlvklkdgseyigkleqtdgtmnlvlrdcteiregtsepvakygrv lirgsnilfisvdyetv
Timeline for d4xq3e_: