Lineage for d1cbs__ (1cbs -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 16455Fold b.60: Lipocalins [50813] (1 superfamily)
  4. 16456Superfamily b.60.1: Lipocalins [50814] (3 families) (S)
  5. 16579Family b.60.1.2: Fatty acid binding protein-like [50847] (10 proteins)
  6. 16596Protein Cellular retinoic-acid-binding protein (CRABP) [50861] (2 species)
  7. 16603Species Human (Homo sapiens), CRABP-II [TaxId:9606] [50862] (7 PDB entries)
  8. 16604Domain d1cbs__: 1cbs - [27201]

Details for d1cbs__

PDB Entry: 1cbs (more details), 1.8 Å

PDB Description: crystal structure of cellular retinoic-acid-binding proteins i and ii in complex with all-trans-retinoic acid and a synthetic retinoid

SCOP Domain Sequences for d1cbs__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cbs__ b.60.1.2 (-) Cellular retinoic-acid-binding protein (CRABP) {Human (Homo sapiens), CRABP-II}
pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvrt
teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtreltndgeli
ltmtaddvvctrvyvre

SCOP Domain Coordinates for d1cbs__:

Click to download the PDB-style file with coordinates for d1cbs__.
(The format of our PDB-style files is described here.)

Timeline for d1cbs__: