Lineage for d4xhma_ (4xhm A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879083Species Archaeoglobus fulgidus [TaxId:224325] [272006] (1 PDB entry)
  8. 2879084Domain d4xhma_: 4xhm A: [272008]
    automated match to d2l4qa_

Details for d4xhma_

PDB Entry: 4xhm (more details), 1.95 Å

PDB Description: archaeoglobus fulgidus thioredoxin 3 m60h
PDB Compounds: (A:) Thioredoxin (Trx-3)

SCOPe Domain Sequences for d4xhma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xhma_ c.47.1.0 (A:) automated matches {Archaeoglobus fulgidus [TaxId: 224325]}
arkvldspvklnssnfdetlknnenvvvdfwaewchpckmiapvieelakeyagkvvfgk
lntdenptiaarygisaiptliffkkgkpvdqlvgampkselkrwvqrnl

SCOPe Domain Coordinates for d4xhma_:

Click to download the PDB-style file with coordinates for d4xhma_.
(The format of our PDB-style files is described here.)

Timeline for d4xhma_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4xhmb_