Lineage for d4wxjb1 (4wxj B:8-263)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2145531Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2145532Protein automated matches [190039] (138 species)
    not a true protein
  7. 2145800Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [272003] (3 PDB entries)
  8. 2145802Domain d4wxjb1: 4wxj B:8-263 [272004]
    automated match to d3g3ib_
    complexed with glu

Details for d4wxjb1

PDB Entry: 4wxj (more details), 2 Å

PDB Description: drosophila muscle gluriib complex with glutamate
PDB Compounds: (B:) Glutamate receptor IIB,Glutamate receptor IIB

SCOPe Domain Sequences for d4wxjb1:

Sequence, based on SEQRES records: (download)

>d4wxjb1 c.94.1.0 (B:8-263) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
pirytvatrvgkpyfswreepegvhyegnerfegyavdliymlaqeckfdfnfepvrdnk
ygsydantdewdgiirqlidnnaqigicdltitqarrsvvdftvpfmqlgisilsykgtd
igslhdlvdqnkvqfgtirggatsvyfsesndtdnrmawnkmlsfkpdaftknneegvdr
vklskgtyaflmettnlqyyvqrnceltqigesfgekhygiavplnadfrsnlsvgilrl
sergelfklrnkwfns

Sequence, based on observed residues (ATOM records): (download)

>d4wxjb1 c.94.1.0 (B:8-263) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
pirytvatrvgkpyfswreepyegnerfegyavdliymlaqeckfdfnfepvrdnkygsy
dantdewdgiirqlidnnaqigicdltitqarrsvvdftvpfmqlgisilsykgtdigsl
hdlvdqnkvqfgtirggatsvyfsesndtdnrmawnkmlsfkpdaftknneegvdrvkls
kgtyaflmettnlqyyvqrnceltqigesfgekhygiavplnadfrsnlsvgilrlserg
elfklrnkwfns

SCOPe Domain Coordinates for d4wxjb1:

Click to download the PDB-style file with coordinates for d4wxjb1.
(The format of our PDB-style files is described here.)

Timeline for d4wxjb1: