Lineage for d4w4nb2 (4w4n B:340-443)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2748634Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)
  7. 2748637Species Human (Homo sapiens) [TaxId:9606] [88590] (69 PDB entries)
    Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region
  8. 2748649Domain d4w4nb2: 4w4n B:340-443 [272002]
    Other proteins in same PDB: d4w4na1, d4w4nb1
    automated match to d1hzhh4
    complexed with gol

Details for d4w4nb2

PDB Entry: 4w4n (more details), 1.8 Å

PDB Description: crystal structure of human fc at 1.80 a
PDB Compounds: (B:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d4w4nb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4w4nb2 b.1.1.2 (B:340-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]}
kgqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvld
sdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsl

SCOPe Domain Coordinates for d4w4nb2:

Click to download the PDB-style file with coordinates for d4w4nb2.
(The format of our PDB-style files is described here.)

Timeline for d4w4nb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4w4nb1