| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (15 species) not a true protein |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [262079] (6 PDB entries) |
| Domain d4uaob2: 4uao B:108-214 [271998] Other proteins in same PDB: d4uaob1, d4uaoc_ automated match to d1c5da2 |
PDB Entry: 4uao (more details), 3.1 Å
SCOPe Domain Sequences for d4uaob2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uaob2 b.1.1.2 (B:108-214) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
radaaptvsifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqd
skdstysmsstlsltkadyeshnlytcevvhktssspvvksfnrnec
Timeline for d4uaob2: