SCOPe 2.08: Domain d4uaob2: 4uao B:108-214

Lineage for d4uaob2 (4uao B:108-214)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [262079] (6 PDB entries)

8. Domain d4uaob2: 4uao B:108-214 [271998]
   Other proteins in same PDB: d4uaob1, d4uaoc_
   automated match to d1c5da2

Details for d4uaob2

PDB Entry: 4uao, 3.1 Å

PDB Description: crystal structure of apical membrane antigen 1 from plasmodium knowlesi in complex with an invasion inhibitory antibody

PDB Compounds: (B:) immunoglobulin R31C2 light chain

SCOPe Domain Sequences for d4uaob2:

Sequence; same for both SEQRES and ATOM records:

>d4uaob2 b.1.1.2 (B:108-214) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
radaaptvsifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqd
skdstysmsstlsltkadyeshnlytcevvhktssspvvksfnrnec

Timeline for d4uaob2:

• d4uaob2 first appeared in SCOPe 2.05
  
• d4uaob2 appears in SCOPe 2.07