Lineage for d4uaob1 (4uao B:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2761339Species Norway rat (Rattus norvegicus) [TaxId:10116] [225064] (19 PDB entries)
  8. 2761397Domain d4uaob1: 4uao B:1-107 [271997]
    Other proteins in same PDB: d4uaob2, d4uaoc_
    automated match to d1c5da1

Details for d4uaob1

PDB Entry: 4uao (more details), 3.1 Å

PDB Description: crystal structure of apical membrane antigen 1 from plasmodium knowlesi in complex with an invasion inhibitory antibody
PDB Compounds: (B:) immunoglobulin R31C2 light chain

SCOPe Domain Sequences for d4uaob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uaob1 b.1.1.0 (B:1-107) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
diqmtqspssmsaslgdrvtitcqasqdignnliwfqqkpgksprrmiyyatklangvps
rfsgsrsgsdysltiislesedmadyhclqykqfpltfgsgtrleik

SCOPe Domain Coordinates for d4uaob1:

Click to download the PDB-style file with coordinates for d4uaob1.
(The format of our PDB-style files is described here.)

Timeline for d4uaob1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4uaob2
View in 3D
Domains from other chains:
(mouse over for more information)
d4uaoc_