| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [225064] (19 PDB entries) |
| Domain d4uaob1: 4uao B:1-107 [271997] Other proteins in same PDB: d4uaob2, d4uaoc_ automated match to d1c5da1 |
PDB Entry: 4uao (more details), 3.1 Å
SCOPe Domain Sequences for d4uaob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uaob1 b.1.1.0 (B:1-107) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
diqmtqspssmsaslgdrvtitcqasqdignnliwfqqkpgksprrmiyyatklangvps
rfsgsrsgsdysltiislesedmadyhclqykqfpltfgsgtrleik
Timeline for d4uaob1: