SCOPe 2.08: Domain d4w4ob2: 4w4o B:340-443

Lineage for d4w4ob2 (4w4o B:340-443)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88590] (69 PDB entries)
   Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region

8. Domain d4w4ob2: 4w4o B:340-443 [271996]
   Other proteins in same PDB: d4w4oa1, d4w4ob1
   automated match to d1hzhh4
   complexed with act, gol, zn

Details for d4w4ob2

PDB Entry: 4w4o, 1.8 Å

PDB Description: high-resolution crystal structure of fc bound to its human receptor fc-gamma-ri

PDB Compounds: (B:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d4w4ob2:

Sequence; same for both SEQRES and ATOM records:

>d4w4ob2 b.1.1.2 (B:340-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]}
kgqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvld
sdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsl

Timeline for d4w4ob2:

• d4w4ob2 first appeared in SCOPe 2.05
  
• d4w4ob2 appears in SCOPe 2.07