Lineage for d4w4ob1 (4w4o B:235-339)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2351136Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)
  7. 2351137Species Human (Homo sapiens) [TaxId:9606] [88585] (58 PDB entries)
    Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region
  8. 2351157Domain d4w4ob1: 4w4o B:235-339 [271995]
    Other proteins in same PDB: d4w4oa2, d4w4ob2
    automated match to d1hzhh3
    complexed with act, bma, fuc, gal, gol, man, nag, zn

Details for d4w4ob1

PDB Entry: 4w4o (more details), 1.8 Å

PDB Description: high-resolution crystal structure of fc bound to its human receptor fc-gamma-ri
PDB Compounds: (B:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d4w4ob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4w4ob1 b.1.1.2 (B:235-339) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
lggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpree
qynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiska

SCOPe Domain Coordinates for d4w4ob1:

Click to download the PDB-style file with coordinates for d4w4ob1.
(The format of our PDB-style files is described here.)

Timeline for d4w4ob1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4w4ob2