Lineage for d1ftpa_ (1ftp A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804862Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2805087Protein Fatty acid-binding protein [50858] (2 species)
  7. 2805088Species Desert locust (Schistocerca gregaria) [TaxId:7010] [50860] (1 PDB entry)
  8. 2805089Domain d1ftpa_: 1ftp A: [27199]

Details for d1ftpa_

PDB Entry: 1ftp (more details), 2.2 Å

PDB Description: three-dimensional structure of the muscle fatty-acid-binding protein isolated from the desert locust, schistocerca gregaria
PDB Compounds: (A:) muscle fatty acid binding protein

SCOPe Domain Sequences for d1ftpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ftpa_ b.60.1.2 (A:) Fatty acid-binding protein {Desert locust (Schistocerca gregaria) [TaxId: 7010]}
vkefagikykldsqtnfeeymkaigvgaierkaglalspvieleildgdkfkltsktaik
nteftfklgeefdeetldgrkvkstitqdgpnklvheqkgdhptiiirefskeqcvitik
lgdlvatriykaq

SCOPe Domain Coordinates for d1ftpa_:

Click to download the PDB-style file with coordinates for d1ftpa_.
(The format of our PDB-style files is described here.)

Timeline for d1ftpa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ftpb_