SCOPe 2.08: Domain d1ftpa_: 1ftp A:

Lineage for d1ftpa_ (1ftp A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Fatty acid-binding protein [50858] (2 species)

7. Species Desert locust (Schistocerca gregaria) [TaxId:7010] [50860] (1 PDB entry)

8. Domain d1ftpa_: 1ftp A: [27199]

Details for d1ftpa_

PDB Entry: 1ftp, 2.2 Å

PDB Description: three-dimensional structure of the muscle fatty-acid-binding protein isolated from the desert locust, schistocerca gregaria

PDB Compounds: (A:) muscle fatty acid binding protein

SCOPe Domain Sequences for d1ftpa_:

Sequence; same for both SEQRES and ATOM records:

>d1ftpa_ b.60.1.2 (A:) Fatty acid-binding protein {Desert locust (Schistocerca gregaria) [TaxId: 7010]}
vkefagikykldsqtnfeeymkaigvgaierkaglalspvieleildgdkfkltsktaik
nteftfklgeefdeetldgrkvkstitqdgpnklvheqkgdhptiiirefskeqcvitik
lgdlvatriykaq

Timeline for d1ftpa_:

• d1ftpa_ first appeared (with stable ids) in SCOP 1.55
  
• d1ftpa_ appears in SCOPe 2.07