![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
![]() | Superfamily b.60.1: Lipocalins [50814] (10 families) ![]() bind hydrophobic ligands in their interior |
![]() | Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins) ten-stranded meander beta-sheet folded upon itself relates to the common fold by opening the barrel and insertion of beta-hairpin |
![]() | Protein Fatty acid-binding protein [50858] (2 species) |
![]() | Species Desert locust (Schistocerca gregaria) [TaxId:7010] [50860] (1 PDB entry) |
![]() | Domain d1ftpa_: 1ftp A: [27199] |
PDB Entry: 1ftp (more details), 2.2 Å
SCOPe Domain Sequences for d1ftpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ftpa_ b.60.1.2 (A:) Fatty acid-binding protein {Desert locust (Schistocerca gregaria) [TaxId: 7010]} vkefagikykldsqtnfeeymkaigvgaierkaglalspvieleildgdkfkltsktaik nteftfklgeefdeetldgrkvkstitqdgpnklvheqkgdhptiiirefskeqcvitik lgdlvatriykaq
Timeline for d1ftpa_: