Lineage for d4rfma1 (4rfm A:357-618)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2544952Protein Tyrosine-protein kinase Itk/Tsk [111194] (1 species)
    PTK group; Tec/Atk subfamily; non-membrane spanning protein tyrosine kinase
  7. 2544953Species Human (Homo sapiens) [TaxId:9606] [111195] (33 PDB entries)
    Uniprot Q08881 357-619
  8. 2544989Domain d4rfma1: 4rfm A:357-618 [271977]
    Other proteins in same PDB: d4rfma2
    automated match to d3v5jb_
    complexed with 3p6

Details for d4rfma1

PDB Entry: 4rfm (more details), 2.1 Å

PDB Description: itk kinase domain in complex with compound 1 n-{1-[(1,1-dioxo-1-thian- 2-yl)(phenyl)methyl]-1h- pyrazol-4-yl}-5,5-difluoro-5a-methyl-1h,4h, 4ah,5h,5ah,6h-cyclopropa[f]indazole-3-carboxamide
PDB Compounds: (A:) Tyrosine-protein kinase ITK/TSK

SCOPe Domain Sequences for d4rfma1:

Sequence, based on SEQRES records: (download)

>d4rfma1 d.144.1.7 (A:357-618) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
vidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmklshp
klvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleea
svihrdlaarnclvgenqvikvsdfgmtrfvlddqytsstgtkfpvkwaspevfsfsrys
sksdvwsfgvlmwevfsegkipyenrsnsevvedistgfrlykprlasthvyqimnhcwk
erpedrpafsrllrqlaaiaas

Sequence, based on observed residues (ATOM records): (download)

>d4rfma1 d.144.1.7 (A:357-618) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
vidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmklshp
klvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleea
svihrdlaarnclvgenqvikvsdfgmtrfpvkwaspevfsfsryssksdvwsfgvlmwe
vfsegkipyenrsnsevvedistgfrlykprlasthvyqimnhcwkerpedrpafsrllr
qlaaiaas

SCOPe Domain Coordinates for d4rfma1:

Click to download the PDB-style file with coordinates for d4rfma1.
(The format of our PDB-style files is described here.)

Timeline for d4rfma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4rfma2