Class b: All beta proteins [48724] (180 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins) ten-stranded meander beta-sheet folded upon itself relates to the common fold by opening the barrel and insertion of beta-hairpin |
Protein Adipocyte lipid-binding protein, ALBP [50856] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [50857] (21 PDB entries) |
Domain d1acda_: 1acd A: [27197] mutant |
PDB Entry: 1acd (more details), 2.7 Å
SCOPe Domain Sequences for d1acda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1acda_ b.60.1.2 (A:) Adipocyte lipid-binding protein, ALBP {Mouse (Mus musculus) [TaxId: 10090]} gdafvgtwklvssenfddymkevgvgfatrkdagmakpnmiisvngdlvtirsesthknt eisfklgvefdeitaddrkvksiitldggalvqvqkwdgksttikrkrdgdklvvecvmk gvtstrvyera
Timeline for d1acda_: