Lineage for d4s1ya3 (4s1y A:389-570)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2009789Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2009790Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2009791Family a.126.1.1: Serum albumin-like [48553] (2 protein domains)
  6. 2009792Protein Serum albumin [48554] (1 species)
    duplication: consists of three domains of this fold
  7. 2009793Species Human (Homo sapiens) [TaxId:9606] [48555] (77 PDB entries)
    Uniprot P02768 29-596
  8. 2010088Domain d4s1ya3: 4s1y A:389-570 [271967]
    automated match to d1n5ua3
    complexed with cpt

Details for d4s1ya3

PDB Entry: 4s1y (more details), 3.16 Å

PDB Description: x-ray structure of human serum albumin complexed with cisplatin
PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d4s1ya3:

Sequence, based on SEQRES records: (download)

>d4s1ya3 a.126.1.1 (A:389-570) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc
aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefnaetft
fhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddketcf
ae

Sequence, based on observed residues (ATOM records): (download)

>d4s1ya3 a.126.1.1 (A:389-570) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc
aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkeictlsek
erqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddketcfae

SCOPe Domain Coordinates for d4s1ya3:

Click to download the PDB-style file with coordinates for d4s1ya3.
(The format of our PDB-style files is described here.)

Timeline for d4s1ya3: