SCOPe 2.07: Domain d4rw7a2: 4rw7 A:430-552

Lineage for d4rw7a2 (4rw7 A:430-552)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (16 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (40 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 bh10 [TaxId:11678] [225195] (20 PDB entries)

8. Domain d4rw7a2: 4rw7 A:430-552 [271961]
   Other proteins in same PDB: d4rw7a1, d4rw7a3, d4rw7b_
   automated match to d2ykna2
   complexed with 3x6

Details for d4rw7a2

PDB Entry: 4rw7, 3.01 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase (k103n, y181c) variant in complex with (e)-3-(3-chloro-5-(2-(2-(2,4-dioxo-3,4- dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj532), a non-nucleoside inhibitor

PDB Compounds: (A:) Reverse transcriptase/ribonuclease H, p66 subunit

SCOPe Domain Sequences for d4rw7a2:

Sequence; same for both SEQRES and ATOM records:

>d4rw7a2 c.55.3.0 (A:430-552) automated matches {Human immunodeficiency virus type 1 bh10 [TaxId: 11678]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klv

Timeline for d4rw7a2:

• d4rw7a2 first appeared in SCOPe 2.05
  
• d4rw7a2 appears in SCOPe 2.06
  
• d4rw7a2 appears in the current release, SCOPe 2.08