| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
| Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
| Protein automated matches [190396] (40 species) not a true protein |
| Species Human immunodeficiency virus type 1 bh10 [TaxId:11678] [225195] (20 PDB entries) |
| Domain d4rw4a2: 4rw4 A:430-552 [271955] Other proteins in same PDB: d4rw4a1, d4rw4a3, d4rw4b_ automated match to d2ykna2 complexed with 494 |
PDB Entry: 4rw4 (more details), 2.67 Å
SCOPe Domain Sequences for d4rw4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rw4a2 c.55.3.0 (A:430-552) automated matches {Human immunodeficiency virus type 1 bh10 [TaxId: 11678]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klv
Timeline for d4rw4a2: