Lineage for d4r11c_ (4r11 C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006908Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 2006909Protein automated matches [190220] (14 species)
    not a true protein
  7. 2006983Species Nematode (Caenorhabditis elegans) [TaxId:6239] [271944] (2 PDB entries)
  8. 2006986Domain d4r11c_: 4r11 C: [271946]
    automated match to d1g3ja_
    complexed with iod

Details for d4r11c_

PDB Entry: 4r11 (more details), 2.79 Å

PDB Description: a conserved phosphorylation switch controls the interaction between cadherin and beta-catenin in vitro and in vivo
PDB Compounds: (C:) Protein humpback-2

SCOPe Domain Sequences for d4r11c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r11c_ a.118.1.0 (C:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
lslpdlvklmcdhdesvvaravhraymlsredpnffnapgfdhrsfvealmaaskssnvn
vrrnaigalshmseqrggpllifrsgglaeiirmlydslesvvhyavttlrnllmhvsds
raqaralnavealtphlhktnpkllaqvadglyflliddapskitflsllgpqilvsilr
eysdhrkliytvvrcirslsvcpsnkpalislgclpalyvelctakdersqtailvamrn
lsdsatneenltqliiklleiirvandgmtacacgtlsnltcnntrnkqtvcshggidal
vtairrlpeveevtepalcalrhctarhslaeeaqselrfcqafpvildqletlrtpvik
aalgvirnsallqtnlieltqeqtanghtavsltmdilrraitaieenpdiavdgvpmwg
viegavsalhqlanhpavaaaccddigqvgnpecppfldllhrllahprlgsmddevler
eilgllyqlskrpdgaravestgvsallmesrgsqyksvvtyangvlsnlkrgdsa

SCOPe Domain Coordinates for d4r11c_:

Click to download the PDB-style file with coordinates for d4r11c_.
(The format of our PDB-style files is described here.)

Timeline for d4r11c_: