SCOPe 2.07: Domain d1a2db_: 1a2d B:

Lineage for d1a2db_ (1a2d B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 protein domains)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Adipocyte lipid-binding protein, ALBP [50856] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [50857] (21 PDB entries)

8. Domain d1a2db_: 1a2d B: [27194]
   complexed with cl

Details for d1a2db_

PDB Entry: 1a2d, 2.4 Å

PDB Description: pyridoxamine modified murine adipocyte lipid binding protein

PDB Compounds: (B:) adipocyte lipid binding protein

SCOPe Domain Sequences for d1a2db_:

Sequence; same for both SEQRES and ATOM records:

>d1a2db_ b.60.1.2 (B:) Adipocyte lipid-binding protein, ALBP {Mouse (Mus musculus) [TaxId: 10090]}
cdafvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdlvtirsestfknt
eisfklgvefdeitaddrkvksiitldggalvqvqkwdgksttikrkrdgdklvvecvmk
gvtstrvyera

Timeline for d1a2db_:

• d1a2db_ first appeared (with stable ids) in SCOP 1.55
  
• d1a2db_ appears in SCOPe 2.06