Lineage for d1a2db_ (1a2d B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804862Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2804863Protein Adipocyte lipid-binding protein, ALBP [50856] (2 species)
  7. 2804902Species Mouse (Mus musculus) [TaxId:10090] [50857] (21 PDB entries)
  8. 2804918Domain d1a2db_: 1a2d B: [27194]
    complexed with cl

Details for d1a2db_

PDB Entry: 1a2d (more details), 2.4 Å

PDB Description: pyridoxamine modified murine adipocyte lipid binding protein
PDB Compounds: (B:) adipocyte lipid binding protein

SCOPe Domain Sequences for d1a2db_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a2db_ b.60.1.2 (B:) Adipocyte lipid-binding protein, ALBP {Mouse (Mus musculus) [TaxId: 10090]}
cdafvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdlvtirsestfknt
eisfklgvefdeitaddrkvksiitldggalvqvqkwdgksttikrkrdgdklvvecvmk
gvtstrvyera

SCOPe Domain Coordinates for d1a2db_:

Click to download the PDB-style file with coordinates for d1a2db_.
(The format of our PDB-style files is described here.)

Timeline for d1a2db_: