![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins) |
![]() | Protein Spore coat protein A, CotA [89219] (2 species) |
![]() | Species Bacillus subtilis [TaxId:224308] [271928] (2 PDB entries) |
![]() | Domain d4q8ba2: 4q8b A:183-356 [271935] automated match to d3zdwa2 complexed with cl, cu, mg, oxy, pge, sxx |
PDB Entry: 4q8b (more details), 1.91 Å
SCOPe Domain Sequences for d4q8ba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4q8ba2 b.6.1.3 (A:183-356) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 224308]} klpsdeydvpllitdrtinedgslfypsapenpspslpnpsivpafcgetilvngkvwpy leveprkyrfrvinasntrtynlsldnggdfiqigsdggllprsvklnsfslapaerydi iidftayegesiilansagcggdvnpetdanimqfrvtkplaqkdesrkpkyla
Timeline for d4q8ba2: