Lineage for d4pdxb2 (4pdx B:543-661)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968249Fold d.106: SCP-like [55717] (1 superfamily)
    alpha-beta(3)-(crossover)-beta-(alpha)-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 32145
  4. 2968250Superfamily d.106.1: SCP-like [55718] (5 families) (S)
  5. 2968313Family d.106.1.0: automated matches [191568] (1 protein)
    not a true family
  6. 2968314Protein automated matches [190987] (4 species)
    not a true protein
  7. 2968315Species Escherichia coli [TaxId:83333] [271890] (1 PDB entry)
  8. 2968317Domain d4pdxb2: 4pdx B:543-661 [271909]
    Other proteins in same PDB: d4pdxa1, d4pdxa3, d4pdxb1, d4pdxb3
    automated match to d2yheb2
    complexed with gol, so4

Details for d4pdxb2

PDB Entry: 4pdx (more details), 1.75 Å

PDB Description: crystal structure of escherchia coli uncharacterized protein yjcs
PDB Compounds: (B:) Putative alkyl/aryl-sulfatase YjcS

SCOPe Domain Sequences for d4pdxb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pdxb2 d.106.1.0 (B:543-661) automated matches {Escherichia coli [TaxId: 83333]}
dtirgmsvemlfdfmavrldsakaagknislnfnmsngdnlnltlndsvlnyrktlqpqa
dasfyisredlhavltgqakmadlvkakkakiigngakleeiiacldnfdlwvnivtpn

SCOPe Domain Coordinates for d4pdxb2:

Click to download the PDB-style file with coordinates for d4pdxb2.
(The format of our PDB-style files is described here.)

Timeline for d4pdxb2: