SCOPe 2.08: Domain d4pdxb2: 4pdx B:543-661

Lineage for d4pdxb2 (4pdx B:543-661)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.106: SCP-like [55717] (1 superfamily)
   alpha-beta(3)-(crossover)-beta-(alpha)-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 32145

4. Superfamily d.106.1: SCP-like [55718] (5 families)

5. Family d.106.1.0: automated matches [191568] (1 protein)
   not a true family

6. Protein automated matches [190987] (4 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [271890] (1 PDB entry)

8. Domain d4pdxb2: 4pdx B:543-661 [271909]
   Other proteins in same PDB: d4pdxa1, d4pdxa3, d4pdxb1, d4pdxb3
   automated match to d2yheb2
   complexed with gol, so4

Details for d4pdxb2

PDB Entry: 4pdx, 1.75 Å

PDB Description: crystal structure of escherchia coli uncharacterized protein yjcs

PDB Compounds: (B:) Putative alkyl/aryl-sulfatase YjcS

SCOPe Domain Sequences for d4pdxb2:

Sequence; same for both SEQRES and ATOM records:

>d4pdxb2 d.106.1.0 (B:543-661) automated matches {Escherichia coli [TaxId: 83333]}
dtirgmsvemlfdfmavrldsakaagknislnfnmsngdnlnltlndsvlnyrktlqpqa
dasfyisredlhavltgqakmadlvkakkakiigngakleeiiacldnfdlwvnivtpn

Timeline for d4pdxb2:

• d4pdxb2 first appeared in SCOPe 2.05
  
• d4pdxb2 appears in SCOPe 2.07