Class b: All beta proteins [48724] (176 folds) |
Fold b.35: GroES-like [50128] (2 superfamilies) contains barrel, partly opened; n*=4, S*=8; meander |
Superfamily b.35.1: GroES-like [50129] (3 families) |
Family b.35.1.0: automated matches [191639] (1 protein) not a true family |
Protein automated matches [191176] (2 species) not a true protein |
Species Homo sapiens [TaxId:9606] [271896] (1 PDB entry) |
Domain d4pj12_: 4pj1 2: [271907] automated match to d1lepa_ complexed with adp, mg |
PDB Entry: 4pj1 (more details), 3.15 Å
SCOPe Domain Sequences for d4pj12_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pj12_ b.35.1.0 (2:) automated matches {Homo sapiens [TaxId: 9606]} gqafrkflplfdrvlversaaetvtkggimlpeksqgkvlqatvvavgsgskgkggeiqp vsvkvgdkvllpeyggtkvvlddkdyflfrdgdilgkyvdklaa
Timeline for d4pj12_: