Lineage for d4pj12_ (4pj1 2:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1785402Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 1785403Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 1785849Family b.35.1.0: automated matches [191639] (1 protein)
    not a true family
  6. 1785850Protein automated matches [191176] (2 species)
    not a true protein
  7. 1785851Species Homo sapiens [TaxId:9606] [271896] (1 PDB entry)
  8. 1785853Domain d4pj12_: 4pj1 2: [271907]
    automated match to d1lepa_
    complexed with adp, mg

Details for d4pj12_

PDB Entry: 4pj1 (more details), 3.15 Å

PDB Description: crystal structure of the human mitochondrial chaperonin symmetrical 'football' complex
PDB Compounds: (2:) 10 kDa heat shock protein, mitochondrial

SCOPe Domain Sequences for d4pj12_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pj12_ b.35.1.0 (2:) automated matches {Homo sapiens [TaxId: 9606]}
gqafrkflplfdrvlversaaetvtkggimlpeksqgkvlqatvvavgsgskgkggeiqp
vsvkvgdkvllpeyggtkvvlddkdyflfrdgdilgkyvdklaa

SCOPe Domain Coordinates for d4pj12_:

Click to download the PDB-style file with coordinates for d4pj12_.
(The format of our PDB-style files is described here.)

Timeline for d4pj12_: