Class b: All beta proteins [48724] (178 folds) |
Fold b.35: GroES-like [50128] (2 superfamilies) contains barrel, partly opened; n*=4, S*=8; meander |
Superfamily b.35.1: GroES-like [50129] (3 families) |
Family b.35.1.0: automated matches [191639] (1 protein) not a true family |
Protein automated matches [191176] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [271896] (2 PDB entries) |
Domain d4pj1t_: 4pj1 T: [271901] Other proteins in same PDB: d4pj122, d4pj1p2, d4pj1u2, d4pj1z2 automated match to d1lepa_ complexed with adp, mg |
PDB Entry: 4pj1 (more details), 3.15 Å
SCOPe Domain Sequences for d4pj1t_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pj1t_ b.35.1.0 (T:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gqafrkflplfdrvlversaaetvtkggimlpeksqgkvlqatvvavgsgskgkggeiqp vsvkvgdkvllpeyggtkvvlddkdyflfrdgdilgkyvd
Timeline for d4pj1t_: