![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.106: SCP-like [55717] (1 superfamily) alpha-beta(3)-(crossover)-beta-(alpha)-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 32145 |
![]() | Superfamily d.106.1: SCP-like [55718] (5 families) ![]() |
![]() | Family d.106.1.0: automated matches [191568] (1 protein) not a true family |
![]() | Protein automated matches [190987] (4 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83333] [271890] (1 PDB entry) |
![]() | Domain d4pdxa2: 4pdx A:543-661 [271891] Other proteins in same PDB: d4pdxa1, d4pdxa3, d4pdxb1, d4pdxb3 automated match to d2yheb2 complexed with gol, so4 |
PDB Entry: 4pdx (more details), 1.75 Å
SCOPe Domain Sequences for d4pdxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pdxa2 d.106.1.0 (A:543-661) automated matches {Escherichia coli [TaxId: 83333]} dtirgmsvemlfdfmavrldsakaagknislnfnmsngdnlnltlndsvlnyrktlqpqa dasfyisredlhavltgqakmadlvkakkakiigngakleeiiacldnfdlwvnivtpn
Timeline for d4pdxa2: